Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL137W  from Saccharomyces cerevisiae S288C
>YKL137W|YKL137W CMC1 SGDID:S000001620, Chr XI from 185957-186292, Genome Release 64-1-1, Verified ORF, "Evolutionarily conserved copper-binding protein of the mitochondrial intermembrane space, may be involved in delivering copper from the matrix to the cytochrome c oxidase complex; contains a twin CX9C motif" ORGANISM: Saccharomyces cerevisiae S288C (111 aa)
MEQNKDPQMISKHSSRLPIWVLSPREEQQARKNLKTETYKKCANFVQAMADCAKANGMKV
FPTCDKQRDEMKSCLLFYQTDEKYLDGERDKIVLEKINKLEKLCQKQSSTK