Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL122C  from Saccharomyces cerevisiae S288C
>YKL122C|YKL122C SRP21 SGDID:S000001605, Chr XI from 212998-212495, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the signal recognition particle (SRP), which functions in protein targeting to the endoplasmic reticulum membrane; not found in mammalian SRP; forms a pre-SRP structure in the nucleolus that is translocated to the cytoplasm" ORGANISM: Saccharomyces cerevisiae S288C (167 aa)
MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNK
SKDVSRLLSALGPRGVSITPGKIEKIAQSKKKNNKIKESSKKIKGKSIQDIVGLATLIVN
TDVEKSDPAAKKTATEPKQKANAVQNNNGNSAASKKKKNKNKGKKKR