Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL119C  from Saccharomyces cerevisiae S288C
>YKL119C|YKL119C VPH2 SGDID:S000001602, Chr XI from 219217-218570, Genome Release 64-1-1, reverse complement, Verified ORF, "Integral membrane protein required for vacuolar H+-ATPase (V-ATPase) function, although not an actual component of the V-ATPase complex; functions in the assembly of the V-ATPase; localized to the endoplasmic reticulum (ER)" ORGANISM: Saccharomyces cerevisiae S288C (215 aa)
MFEIKLNDRITEFLRKFKNSAKSNEGIDEDIDLFLKRHAIPMQSLLFYVKEYRKDSDLQC
SIKELLKPLEFEFKPKAVRGLHYSEDFKKKLEFLKYQEQELEYQSMVKRSKSVFSLQEDD
ELTPSQINKQIKEQVTTVFNVLVSVISVVVAIWYWTGSSTNFPVHVRLLLCLFFGILVLV
ADVVVYNSYLKKLEEAKVKEKTKVEKKKVLSKITL