Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL106C-A  from Saccharomyces cerevisiae S288C
>YKL106C-A|YKL106C-A YKL106C-A SGDID:S000007616, Chr XI from 237266-237147, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by homology to uncharacterized proteins in other fungi" ORGANISM: Saccharomyces cerevisiae S288C (39 aa)
MPFPSILHLTIGRYASYDSNNHMRRRAKLMEAIFRIRTI