Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL096W-A  from Saccharomyces cerevisiae S288C
>YKL096W-A|YKL096W-A CWP2 SGDID:S000001956, Chr XI from 259253-259531, Genome Release 64-1-1, Verified ORF, "Covalently linked cell wall mannoprotein, major constituent of the cell wall; plays a role in stabilizing the cell wall; involved in low pH resistance; precursor is GPI-anchored" ORGANISM: Saccharomyces cerevisiae S288C (92 aa)
MQFSTVASVAFVALANFVAAESAAAISQITDGQIQATTTATTEATTTAAPSSTVETVSPS
STETISQQTENGAAKAAVGMGAGALAAAAMLL