Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL086W  from Saccharomyces cerevisiae S288C
>YKL086W|YKL086W SRX1 SGDID:S000001569, Chr XI from 278281-278664, Genome Release 64-1-1, Verified ORF, "Sulfiredoxin, contributes to oxidative stress resistance by reducing cysteine-sulfinic acid groups in the peroxiredoxin Tsa1p, which is formed upon exposure to oxidants; conserved in higher eukaryotes" ORGANISM: Saccharomyces cerevisiae S288C (127 aa)
MSLQSNSVKPTEIPLSEIRRPLAPVLDPQKIDAMVATMKGIPTASKTCSLEQAEAAASAG
ELPPVDVLGVRVKGQTLYYAFGGCHRLQAYDRRARETQNAAFPVRCRVLPATPRQIRMYL
GSSLDIE