Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL084W  from Saccharomyces cerevisiae S288C
>YKL084W|YKL084W HOT13 SGDID:S000001567, Chr XI from 280509-280859, Genome Release 64-1-1, Verified ORF, "Zinc-binding mitochondrial intermembrane space (IMS) protein involved in a disulfide relay system for IMS import of cysteine-containing proteins; binds Mia40p and stimulates its Erv1p-dependent oxidation, probably by sequestering zinc" ORGANISM: Saccharomyces cerevisiae S288C (116 aa)
MIETAIYGKTVDDQSRCVHWHLPKDVIAIRFKCCDKYYACFECHQELSSHPLEKYDLLDD
ANKHLIICGVCRHEMTFAEYYDYNSNLICPNCRSPFNPGCKLHYHLYFQNPPPAMC