Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL070W  from Saccharomyces cerevisiae S288C
>YKL070W|YKL070W YKL070W SGDID:S000001553, Chr XI from 306211-306720, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; expression induced in cells treated with mycotoxins patulin or citrinin; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies" ORGANISM: Saccharomyces cerevisiae S288C (169 aa)
MYIPKHFESMELSRYKLSKKPPLGTLFSSKASRQGFFGWRTSSNKDDPDFGMCASHIPFV
FVEFDNGEHKLIAHLARKNKHVEMLERVQKCLVVFQSVDSYISPAWFPMKKKTHKFVPTW
DFAAVHVYGTPRIIRDDKDWLINMLSTLTDQEEEKRPEGENVRSKVERF