Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL069W  from Saccharomyces cerevisiae S288C
>YKL069W|YKL069W YKL069W SGDID:S000001552, Chr XI from 307285-307827, Genome Release 64-1-1, Verified ORF, "Methionine-R-sulfoxide reductase, reduces the R enantiomer of free Met-SO, in contrast to Ycl033Cp which reduces Met-R-SO in a peptide linkage; has a role in protection against oxidative stress" ORGANISM: Saccharomyces cerevisiae S288C (180 aa)
MGSSTGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSL
AVDINWAGFYVTQASEENTLILGPFQGKVACQMIQFGKGVCGTAASTKETQIVPDVNKYP
GHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDKEFLEKLAKLINKSCVFK