Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL067W  from Saccharomyces cerevisiae S288C
>YKL067W|YKL067W YNK1 SGDID:S000001550, Chr XI from 314812-315273, Genome Release 64-1-1, Verified ORF, "Nucleoside diphosphate kinase, catalyzes the transfer of gamma phosphates from nucleoside triphosphates, usually ATP, to nucleoside diphosphates by a mechanism that involves formation of an autophosphorylated enzyme intermediate" ORGANISM: Saccharomyces cerevisiae S288C (153 aa)
MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKP
FFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHG
SDSVDSAEREINLWFKKEELVDWESNQAKWIYE