Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL063C  from Saccharomyces cerevisiae S288C
>YKL063C|YKL063C YKL063C SGDID:S000001546, Chr XI from 321518-321015, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the Golgi" ORGANISM: Saccharomyces cerevisiae S288C (167 aa)
MQGDIRRKKDLLPRYKTGSKYNSRRRGGYLTTPMKKIIVYIILLCGVYFVIKVAYSDLNK
ETEIKLESHSSDVSASASDHTNIAAGGAADATNNKQPQQAKVPKEKFNNEVAKQQEVKNL
ENDLKPQIDSEKQKQINKDKKEQKQQLQKEKQDLAKENLANNEILDN