Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL061W  from Saccharomyces cerevisiae S288C
>YKL061W|YKL061W BLI1 SGDID:S000001544, Chr XI from 325771-326112, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; likely member of BLOC complex involved in endosomal cargo sorting; green fluorescent protein (GFP)-fusion protein localizes to the endosome" ORGANISM: Saccharomyces cerevisiae S288C (113 aa)
MGEQNKLYYDVEKLVNSLQESFDLDCAQSVSLFTSKSRSNEAWLEELENKFKLKDDVELD
DVENLRAEIDMKLNMLEDKVSYYERLYKELEEFQNEIKIKTVVNNRRQSRTPK