Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL058W  from Saccharomyces cerevisiae S288C
>YKL058W|YKL058W TOA2 SGDID:S000001541, Chr XI from 330166-330534, Genome Release 64-1-1, Verified ORF, "TFIIA small subunit; involved in transcriptional activation, acts as antirepressor or as coactivator; homologous to smallest subunit of human and Drosophila TFIIA" ORGANISM: Saccharomyces cerevisiae S288C (122 aa)
MAVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKL
TVKGNLDTYGFCDDVWTFIVKNCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNSKK
SE