Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL056C  from Saccharomyces cerevisiae S288C
>YKL056C|YKL056C TMA19 SGDID:S000001539, Chr XI from 334915-334412, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein that associates with ribosomes; homolog of translationally controlled tumor protein; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and relocates to the mitochondrial outer surface upon oxidative stress" ORGANISM: Saccharomyces cerevisiae S288C (167 aa)
MIIYKDIFSNDELLSDAYDAKLVDDVIYEADCAMVNVGGDNIDIGANPSAEGGDDDVEEG
AEMVNNVVHSFRLQQTAFDKKSFLTYIKGYMKAVKAKLQETNPEEVPKFEKGAQTYVKKV
IGSFKDWEFFTGESMDPDAMVVMLNYREDGTTPFVAIWKHGIVEEKI