Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL053C-A  from Saccharomyces cerevisiae S288C
>YKL053C-A|YKL053C-A MDM35 SGDID:S000007243, Chr XI from 339442-339182, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial intermembrane space protein; mutation affects mitochondrial distribution and morphology; contains twin cysteine-x9-cysteine motifs" ORGANISM: Saccharomyces cerevisiae S288C (86 aa)
MGNIMSASFAPECTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVNAALVKQ
GIKPALDEAREEAPFENGGKLKEVDK