Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL041W  from Saccharomyces cerevisiae S288C
>YKL041W|YKL041W VPS24 SGDID:S000001524, Chr XI from 360143-360817, Genome Release 64-1-1, Verified ORF, "One of four subunits of the endosomal sorting complex required for transport III (ESCRT-III); forms an ESCRT-III subcomplex with Did4p; involved in the sorting of transmembrane proteins into the multivesicular body (MVB) pathway" ORGANISM: Saccharomyces cerevisiae S288C (224 aa)
MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT
VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR
LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK
NVDQVPTVELAANEEEQEIPDEKVDEEADRMVNEMRERLRALQN