Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL037W  from Saccharomyces cerevisiae S288C
>YKL037W|YKL037W AIM26 SGDID:S000001520, Chr XI from 369365-369721, Genome Release 64-1-1, Verified ORF, "Putative protein of unknown function; null mutant is viable and displays elevated frequency of mitochondrial genome loss; null mutation confers sensitivity to tunicamycin and DTT" ORGANISM: Saccharomyces cerevisiae S288C (118 aa)
MQTMGGEHLLLSQLKGSFFLLLLAYFFRGRSPYYARCYRRLAVTPGAITIAIAIATDSIP
ALAKSKVLVSVCSHTDPCTASCNLIPFPRPFSNSLTRFLFCLGSARFCISFPCFGLSI