Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL026C  from Saccharomyces cerevisiae S288C
>YKL026C|YKL026C GPX1 SGDID:S000001509, Chr XI from 389883-389380, Genome Release 64-1-1, reverse complement, Verified ORF, "Phospholipid hydroperoxide glutathione peroxidase induced by glucose starvation that protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress" ORGANISM: Saccharomyces cerevisiae S288C (167 aa)
MQEFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKSHGLVIV
AFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGI
KMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELLNQPPEEQI