Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL013C  from Saccharomyces cerevisiae S288C
>YKL013C|YKL013C ARC19 SGDID:S000001496, Chr XI from 418023-417508, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the ARP2/3 complex, which is required for the motility and integrity of cortical actin patches" ORGANISM: Saccharomyces cerevisiae S288C (171 aa)
MSQSLRPYLTAVRYSLEAALTLSNFSSQEVERHNRPEVEVPNTSAELLLQPMHISRNENE
QVLIEPSVNSVRMSLMVKQADEIEQILVHKFTRFLEQRAEAFYILRRVPIPGYSISFLIT
NKHTESMKTGKLVDFIIEFMEDVDKEISEIKLFLNARARFVAEAYLDEFVY