Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL006W  from Saccharomyces cerevisiae S288C
>YKL006W|YKL006W RPL14A SGDID:S000001489, Chr XI from 431906-432034,432433-432720, Genome Release 64-1-1, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl14Bp and has similarity to rat L14 ribosomal protein; rpl14a csh5 double null mutant exhibits synthetic slow growth" ORGANISM: Saccharomyces cerevisiae S288C (138 aa)
MSTDSIVKASNWRLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKAGVPRQAINL
GQVVLTPLTFALPRGARTATVSKKWAAAAVCEKWAASSWAKKIAQRERRAALTDFERFQV
MVLRKQKRYTVKKALAKA