Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR135W-A  from Saccharomyces cerevisiae S288C
>YJR135W-A|YJR135W-A TIM8 SGDID:S000007348, Chr X from 676971-677234, Genome Release 64-1-1, Verified ORF, "Mitochondrial intermembrane space protein, forms a complex with Tim13p that delivers a subset of hydrophobic proteins to the TIM22 complex for inner membrane insertion; homolog of human TIMM8A, implicated in Mohr-Tranebjaerg syndrome" ORGANISM: Saccharomyces cerevisiae S288C (87 aa)
MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQ
EEQCLSNCVNRFLDTNIRIVNGLQNTR