Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR120W  from Saccharomyces cerevisiae S288C
>YJR120W|YJR120W YJR120W SGDID:S000003881, Chr X from 647126-647476, Genome Release 64-1-1, Verified ORF, "Protein of unknown function; essential for growth under anaerobic conditions; mutation causes decreased expression of ATP2, impaired respiration, defective sterol uptake, and altered levels/localization of ABC transporters Aus1p and Pdr11p" ORGANISM: Saccharomyces cerevisiae S288C (116 aa)
MRWDVIILYAISRPYATRRTGSHTHPRDSRYIAANQRRPPSACRVGPSPAKQRKDIPIFE
LLDTTLIKNALFALTSFLYYRTNILTCPFLNFLYLSRTGQLDKFCKDQTVTQILAT