Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YJR094W-A  from Saccharomyces cerevisiae S288C
>YJR094W-A|YJR094W-A RPL43B SGDID:S000003855, Chr X from 608305-608306,608582-608858, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl43Ap and has similarity to rat L37a ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (92 aa)
MAKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGAAGIWTCSCC
KKTVAGGAYTVSTAAAATVRSTIRRLREMVEA