Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR085C  from Saccharomyces cerevisiae S288C
>YJR085C|YJR085C YJR085C SGDID:S000003845, Chr X from 585437-585120, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; GFP-fusion protein is induced in response to the DNA-damaging agent MMS; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies" ORGANISM: Saccharomyces cerevisiae S288C (105 aa)
MEHPAYTLSLLTTAGGLMGYYRKGSIPSLVSGLVFGSVYGIAGYLLHMNRDGGLEMALGA
STLLLGAGVIRGMPSRFTKPVPVVLTALGGLGSYYYYNKYKEFYP