Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YJR082C  from Saccharomyces cerevisiae S288C
>YJR082C|YJR082C EAF6 SGDID:S000003842, Chr X from 582255-581914, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the NuA4 acetyltransferase complex that acetylates histone H4 and NuA3 acetyltransferase complex that acetylates histone H3" ORGANISM: Saccharomyces cerevisiae S288C (113 aa)
MTDELKSYEALKAELKKSLQDRREQEDTFDNLQQEIYDKETEYFSHNSNNNHSGHGGAHG
SKSHYSGNIIKGFDTFSKSHHSHADSAFNNNDRIFSLSSATYVKQQHGQSQND