Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR074W  from Saccharomyces cerevisiae S288C
>YJR074W|YJR074W MOG1 SGDID:S000003835, Chr X from 573095-573751, Genome Release 64-1-1, Verified ORF, "Conserved nuclear protein that interacts with GTP-Gsp1p, which is a Ran homolog of the Ras GTPase family, and stimulates nucleotide release, involved in nuclear protein import, nucleotide release is inhibited by Yrb1p" ORGANISM: Saccharomyces cerevisiae S288C (218 aa)
MKIEKASHISQPVQLSTCTLIDTYPGHQGSMNNKEVELYGGAITTVVPPGFIDASTLREV
PDTQEVYVNSRRDEEEFEDGLATNESIIVDLLETVDKSDLKEAWQFHVEDLTELNGTTKW
EALQEDTVQQGTKFTGLVMEVANKWGKPDLAQTVVIGVALIRLTQFDTDVVISINVPLTK
EEASQASNKELPARCHAVYQLLQEMVRKFHVVDTSLFA