Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR067C  from Saccharomyces cerevisiae S288C
>YJR067C|YJR067C YAE1 SGDID:S000003828, Chr X from 567444-567019, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function, essential for growth under standard (aerobic) conditions but not under anaerobic conditions" ORGANISM: Saccharomyces cerevisiae S288C (141 aa)
MSNTWDDVWASDSDVETERSPDLVKLRENHSKRGYLDGIVSSKEEKLQEGFNDGFPTGAK
LGKQVGIIMGILLGLRTRFGDEDEDLSKAYIDAQKELRINKVLSKSIFDPNFDLQEKHPL
ITKWTDIANTYCEKYHVPSIQ