Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR063W  from Saccharomyces cerevisiae S288C
>YJR063W|YJR063W RPA12 SGDID:S000003824, Chr X from 555195-555572, Genome Release 64-1-1, Verified ORF, "RNA polymerase I subunit A12.2; contains two zinc binding domains, and the N terminal domain is responsible for anchoring to the RNA pol I complex" ORGANISM: Saccharomyces cerevisiae S288C (125 aa)
MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSL
RAKKSVVKTSLKKNELKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYK
FRTNN