Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR058C  from Saccharomyces cerevisiae S288C
>YJR058C|YJR058C APS2 SGDID:S000003819, Chr X from 545175-544732, Genome Release 64-1-1, reverse complement, Verified ORF, "Small subunit of the clathrin-associated adaptor complex AP-2, which is involved in protein sorting at the plasma membrane; related to the sigma subunit of the mammalian plasma membrane clathrin-associated protein (AP-2) complex" ORGANISM: Saccharomyces cerevisiae S288C (147 aa)
MAVQFILCFNKQGVVRLVRWFDVHSSDPQRSQDAIAQIYRLISSRDHKHQSNFVEFSDST
KLIYRRYAGLYFVMGVDLLDDEPIYLCHIHLFVEVLDAFFGNVCELDIVFNFYKVYMIMD
EMFIGGEIQEISKDMLLERLSILDRLD