Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR047C  from Saccharomyces cerevisiae S288C
>YJR047C|YJR047C ANB1 SGDID:S000003808, Chr X from 525381-524908, Genome Release 64-1-1, reverse complement, Verified ORF, "Translation elongation factor eIF-5A, previously thought to function in translation initiation; similar to and functionally redundant with Hyp2p; undergoes an essential hypusination modification; expressed under anaerobic conditions" ORGANISM: Saccharomyces cerevisiae S288C (157 aa)
MSDEEHTFENADAGASATYPMQCSALRKNGFVVIKGRPCKIVDMSTSKTGKHGHAKVHLV
TLDIFTGKKLEDLSPSTHNLEVPFVKRSEYQLLDIDDGYLSLMTMDGETKDDVKAPEGEL
GDSMQAAFDEGKDLMVTIISAMGEEAAISFKEAPRSD