Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR044C  from Saccharomyces cerevisiae S288C
>YJR044C|YJR044C VPS55 SGDID:S000003805, Chr X from 519185-518763, Genome Release 64-1-1, reverse complement, Verified ORF, "Late endosomal protein involved in late endosome to vacuole trafficking; functional homolog of human obesity receptor gene-related protein (OB-RGRP)" ORGANISM: Saccharomyces cerevisiae S288C (140 aa)
MMEFKVSPLTKIISLSGFLALGFLLVILSCALFHNYYPLFDILIFLLAPIPNTIFNAGNK
YHTSDFMSDSSNTGQDLAHFLTGMLVTSGIALPVVFYHCQLIGHLSCIMCMIGGLIIYSS
IVIFKWFFKKDFNEDDSLFG