Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR034W  from Saccharomyces cerevisiae S288C
>YJR034W|YJR034W PET191 SGDID:S000003795, Chr X from 496683-497009, Genome Release 64-1-1, Verified ORF, "Protein required for assembly of cytochrome c oxidase; exists as an oligomer that is integral to the mitochondrial inner membrane and faces the intermembrane space; contains a twin Cx9C motif" ORGANISM: Saccharomyces cerevisiae S288C (108 aa)
MVASCKDQKKAVAICLQRSPCVMIERHNPQECLDNPELNKDLPELCIAQMKAFLDCKRGI
VDMTKRFTGNAPLSTGKYDQQYENLCKGKFDPREEMEKLKLLNSQQKD