Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR025C  from Saccharomyces cerevisiae S288C
>YJR025C|YJR025C BNA1 SGDID:S000003786, Chr X from 471671-471138, Genome Release 64-1-1, reverse complement, Verified ORF, "3-hydroxyanthranilic acid dioxygenase, required for the de novo biosynthesis of NAD from tryptophan via kynurenine; expression regulated by Hst1p" ORGANISM: Saccharomyces cerevisiae S288C (177 aa)
MFNTTPINIDKWLKENEGLLKPPVNNYCLHKGGFTVMIVGGPNERTGYHINPTPEWFYQK
KGSMLLKVVDETDAEPKFIDIIINEGDSYLLPGNVPHSPVRFADTVGIVVEQDRPGGEND
KIRWYCSHCRQVVHESELQMLDLGTQVKEAILDFENDVEKRTCFHCKTLNYARPQSN