Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR022W  from Saccharomyces cerevisiae S288C
>YJR022W|YJR022W LSM8 SGDID:S000003783, Chr X from 469784-470113, Genome Release 64-1-1, Verified ORF, "Lsm (Like Sm) protein; forms heteroheptameric complex (with Lsm2p, Lsm3p, Lsm4p, Lsm5p, Lsm6p, and Lsm7p) that is part of spliceosomal U6 snRNP and is also implicated in processing of pre-tRNA, pre-snoRNA, and pre-rRNA" ORGANISM: Saccharomyces cerevisiae S288C (109 aa)
MSATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSE
IALVGLIDAENDDSLAPIDEKKVPMLKDTKNKIENEHVIWEKVYESKTK