Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR014W  from Saccharomyces cerevisiae S288C
>YJR014W|YJR014W TMA22 SGDID:S000003775, Chr X from 461829-462425, Genome Release 64-1-1, Verified ORF, "Protein of unknown function; associates with ribosomes and has a putative RNA binding domain; interacts with Tma20p; similar to human GRAP and human DRP1, which interacts with human Tma20p homolog MCT-1" ORGANISM: Saccharomyces cerevisiae S288C (198 aa)
MLREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLA
ESSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEV
FDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGLKDVKV
ETIDAKKKKKPAAEGAAK