Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJR010C-A  from Saccharomyces cerevisiae S288C
>YJR010C-A|YJR010C-A SPC1 SGDID:S000003770, Chr X from 458361-458077, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the signal peptidase complex (SPC), which cleaves the signal sequence from proteins targeted to the endoplasmic reticulum (ER), homolog of the SPC12 subunit of mammalian signal peptidase complex" ORGANISM: Saccharomyces cerevisiae S288C (94 aa)
MSEILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISC
VITLICVLPAYPWYNKQKLRWAQPKIEINVDQYD