Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL223C  from Saccharomyces cerevisiae S288C
>YJL223C|YJL223C PAU1 SGDID:S000003759, Chr X from 9138-8776, Genome Release 64-1-1, reverse complement, Verified ORF, "Member of the seripauperin multigene family encoded mainly in subtelomeric regions, active during alcoholic fermentation, regulated by anaerobiosis, negatively regulated by oxygen, repressed by heme; identical to Pau14p" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTE
TYPVEVAEAVFNYGDFTTMLTGISPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIAN