Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL217W  from Saccharomyces cerevisiae S288C
>YJL217W|YJL217W REE1 SGDID:S000003753, Chr X from 23133-23729, Genome Release 64-1-1, Verified ORF, "Cytoplasmic protein involved in the regulation of enolase (ENO1); mRNA expression is induced by calcium shortage, copper deficiency (via Mac1p) and the presence of galactose (via Gal4p); mRNA expression is also regulated by the cell cycle" ORGANISM: Saccharomyces cerevisiae S288C (198 aa)
MVESKNTELSQGTWLNKPKSVFQEAGKVTLETDEKTDFWRETFYGFTRDSGHFLGVETGS
AFTAQVRVQGSYESLYDQAGIMVRIDDGHWLKAGIEISDGHAMLSSVLTNGKSDWSTAVY
GGNARDFWLRVTVEKGVLRIQVSSDKKTWPLVRLAPFPTSDHYLVGPMACTPERGGLKVT
FSEWSLTAPLGKALHDLS