Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL205C  from Saccharomyces cerevisiae S288C
>YJL205C|YJL205C NCE101 SGDID:S000003742, Chr X from 50268-50139,50443-50412, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function, involved in secretion of proteins that lack classical secretory signal sequences" ORGANISM: Saccharomyces cerevisiae S288C (53 aa)
MVQYAPFLLGKFSDPLLAIMVGCLSYYVYERKMGRPQGHHLHELIKKRWDDRK