Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL191W  from Saccharomyces cerevisiae S288C
>YJL191W|YJL191W RPS14B SGDID:S000003727, Chr X from 73787-73796,74205-74611, Genome Release 64-1-1, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Ap and similar to E. coli S11 and rat S14 ribosomal proteins" ORGANISM: Saccharomyces cerevisiae S288C (138 aa)
MANDLVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYA
AMLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVT
PVPSDSTRKKGGRRGRRL