Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL190C  from Saccharomyces cerevisiae S288C
>YJL190C|YJL190C RPS22A SGDID:S000003726, Chr X from 75302-74910, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps22Bp and has similarity to E. coli S8 and rat S15a ribosomal proteins" ORGANISM: Saccharomyces cerevisiae S288C (130 aa)
MTRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK
IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH
VSGKILGFVY