Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL189W  from Saccharomyces cerevisiae S288C
>YJL189W|YJL189W RPL39 SGDID:S000003725, Chr X from 75933-75938,76325-76474, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to rat L39 ribosomal protein; required for ribosome biogenesis; loss of both Rpl31p and Rpl39p confers lethality; also exhibits genetic interactions with SIS1 and PAB1" ORGANISM: Saccharomyces cerevisiae S288C (51 aa)
MAAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI