Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL184W  from Saccharomyces cerevisiae S288C
>YJL184W|YJL184W GON7 SGDID:S000003720, Chr X from 83448-83819, Genome Release 64-1-1, Verified ORF, "Component of the EKC/KEOPS protein complex with Kae1p, Cgi121p, Pcc1p, and Bud32p; EKC/KEOPS complex is required for t6A tRNA modification and may have roles in telomere maintenance and transcription; implicated in osmotic stress response" ORGANISM: Saccharomyces cerevisiae S288C (123 aa)
MKLPVAQYSAPDGVEKSFAPIRDDPRYMTTEGRTTGPSDHVLNAGQIDRDKPSEPERTKD
GSQLTYLGQLRTQLTGLQDDINEFLTGRMELAKNKKKAGADEKRIQEEINQLLDGGDGDE
DAV