Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL179W  from Saccharomyces cerevisiae S288C
>YJL179W|YJL179W PFD1 SGDID:S000003715, Chr X from 88787-89116, Genome Release 64-1-1, Verified ORF, "Subunit of heterohexameric prefoldin, which binds cytosolic chaperonin and transfers target proteins to it; involved in the biogenesis of actin and of alpha- and gamma-tubulin" ORGANISM: Saccharomyces cerevisiae S288C (109 aa)
MSQIAQEMTVSLRNARTQLDMVNQQLAYLDRQEKLAELTKKELESYPTDKVWRSCGKSFI
LQDKSKYVNDLSHDETVLLDQRKTLKIKKNYLETTVEKTIDNLKALMKN