Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL173C  from Saccharomyces cerevisiae S288C
>YJL173C|YJL173C RFA3 SGDID:S000003709, Chr X from 96529-96161, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of heterotrimeric Replication Protein A (RPA), which is a highly conserved single-stranded DNA binding protein involved in DNA replication, repair, and recombination" ORGANISM: Saccharomyces cerevisiae S288C (122 aa)
MASETPRVDPTEISNVNAPVFRIIAQIKSQPTESQLILQSPTISSKNGSEVEMITLNNIR
VSMNKTFEIDSWYEFVCRNNDDGELGFLILDAVLCKFKENEDLSLNGVVALQRLCKKYPE
IY