Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL166W  from Saccharomyces cerevisiae S288C
>YJL166W|YJL166W QCR8 SGDID:S000003702, Chr X from 106434-106718, Genome Release 64-1-1, Verified ORF, "Subunit 8 of ubiquinol cytochrome-c reductase complex, which is a component of the mitochondrial inner membrane electron transport chain; oriented facing the intermembrane space; expression is regulated by Abf1p and Cpf1p" ORGANISM: Saccharomyces cerevisiae S288C (94 aa)
MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVL
IPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV