Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL151C  from Saccharomyces cerevisiae S288C
>YJL151C|YJL151C SNA3 SGDID:S000003687, Chr X from 136773-136372, Genome Release 64-1-1, reverse complement, Verified ORF, "Integral membrane protein localized to vacuolar intralumenal vesicles, computational analysis of large-scale protein-protein interaction data suggests a possible role in either cell wall synthesis or protein-vacuolar targeting" ORGANISM: Saccharomyces cerevisiae S288C (133 aa)
MDRDHINDHDHRMSYSINKDDLLLMVLAVFIPPVAVWKRKGMFNRDTLLNLLLFLLLFFP
AIIHACYVVYETSSERSYDLSRRHATAPAVDRDLEAHPAEESQAQPPAYDEDDEAGADVP
LMDNKQQLSSGRT