Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL144W  from Saccharomyces cerevisiae S288C
>YJL144W|YJL144W YJL144W SGDID:S000003680, Chr X from 146359-146673, Genome Release 64-1-1, Verified ORF, "Cytoplasmic hydrophilin with a role in dessication resistance; expression induced by osmotic stress, starvation and during stationary phase; GFP-fusion protein is induced by the DNA-damaging agent MMS" ORGANISM: Saccharomyces cerevisiae S288C (104 aa)
MLRRETSTIYRTHKKSNSSILRSQRDQTRVDSLVEESPMGDFGINNQPTQPGVIYYFVEL
TNLGIQENTSSNNNNNNNHGDDENGSRYGHGSSLGGDVHSRRCS