Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL140W  from Saccharomyces cerevisiae S288C
>YJL140W|YJL140W RPB4 SGDID:S000003676, Chr X from 150961-151626, Genome Release 64-1-1, Verified ORF, "RNA polymerase II subunit B32; forms two subunit dissociable complex with Rpb7p; involved in recruitment of 3'-end processing factors to transcribing RNA polymerase II complex and in export of mRNA to cytoplasm under stress conditions; also involved in translation initiation" ORGANISM: Saccharomyces cerevisiae S288C (221 aa)
MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIK
EALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETRE
KELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQL
GSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY