Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YJL136C  from Saccharomyces cerevisiae S288C
>YJL136C|YJL136C RPS21B SGDID:S000003672, Chr X from 156789-156550,157273-157250, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps21Ap and has similarity to rat S21 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (87 aa)
MENDKGQLVELYVPRKCSATNRIIKADDHASVQINVAKVDEEGRAIPGEYITYALSGYVR
SRGESDDSLNRLAQNDGLLKNVWSYSR